Resultado da Pesquisa
A expressão de busca foi <secondaryty pi and firstg CST-CST-INPE-MCTI-GOV-BR and y 2016 and dissemination websci>.
26 referências foram encontradas buscando em 15 dentre 15 sites
(este total pode incluir algumas duplicadas - para ver a conta certa clique no botão Mostrar Todas).
As 10 mais recentes estão listadas abaixo.
Data e hora local de busca: 19/10/2020 13:32.

Tipo da ReferênciaJournal Article
Identificador8JMKD3MGP3W/3MTN38F
Repositóriosid.inpe.br/plutao/2016/12.05.19.18.31   (acesso restrito)
Metadadossid.inpe.br/plutao/2016/12.05.19.18.32
Siteplutao.sid.inpe.br
DOI10.1111/gcb.13315
Rótulolattes: 5174466549126882 28 JohnsonGGDGRTVVMPBFLFQCCGKMMZAAAAAAAAABBBBCCCCCDFHHKLLLLMMMMMNPPPPPRRRSSSSTTTTVVVVVB:2016:ImDyGl
ISSN1354-1013
Código do Detentorisadg {BR SPINPE} ibi 8JMKD3MGPCW/3DT298S
Chave de CitaçãoJohnsonGGDGRTVVMPBFLFQCCOKMMZAOAAAAAAABBBBCCCCCDFHHKLLLLMMMMMNPPPPPRRRSSSSTTTTVVVVVB:2016:ImDyGl
Autor 1 Johnson, M. O.
 2 Galbraith, D.
 3 Gloor, E.
 4 Deurwaerder, H. de
 5 Guimberteau, M.
 6 Rammig, A.
 7 Thonicke, K.
 8 Verbeeck, H.
 9 Von Randow, Celso
10 Monteagudo, A
11 Phillips, O. L.
12 Brienen, R. J. W.
13 Feldpausch, T. R.
14 Lopez Gonzalez, G.
15 Fauset, S.
16 Quesada, C. A.
17 Christoffersen, B.
18 Ciais, P.
19 Oliveira, Gilvan Sampaio de
20 Kruijt, B.
21 Meir, P.
22 Moorcroft, P.
23 Zhang, K.
24 Alvarez, E. A.
25 Oliveira, A. Alves de
26 Amaral, I.
27 Andrade, A.
28 Aragão, Luiz Eduardo Oliveira e Cruz de
29 Araujo-Murakami, A.
30 Arets, E. J. M. M.
31 Arroyo, L.
32 Aymard, G. A.
33 Baraloto, C.
34 Barroso, J.
35 Bonal, D.
36 Boot, R.
37 Camargo, J.
38 Chave, Jerome
39 Cogollo, A.
40 Cornejo, F. Valverde
41 Costa, L. da
42 Di Fiore, A.
43 Ferreira, L.
44 Higuchi, N.
45 Honorio, E.
46 Killeen, T. J.
47 Laurance, S. G.
48 Laurance, W. F.
49 Licona, J.
50 Lovejoy, T.
51 Malhi, Y.
52 Marimon, B.
53 Marimon Junior, B. H.
54 Matos, D. C. L.
55 Mendoza, C.
56 Neill, D. A.
57 Pardo, G.
58 Peña-Claros, M.
59 Pitman, N. C. A.
60 Poorter, L.
61 Prieto, A
62 Ramirez-Angulo, H.
63 Roopsind, A.
64 Rudas, A.
65 Salomao, R. P.
66 Silveira, M.
67 Stropp, J.
68 ter Steege, H.
69 Terborgh, J.
70 Thomas, R.
71 Toledo, M.
72 Torres-Lezama, A.
73 Van Der Heijden, G. M. F.
74 Vasquez, R.
75 Vieira, I.
76 Vilanova, E.
77 Vos, V. A.
78 Baker, T. R.
Identificador de Curriculo 1
 2
 3
 4
 5
 6
 7
 8
 9
10
11
12
13
14
15
16
17
18
19 8JMKD3MGP5W/3C9JHBE
Grupo 1
 2
 3
 4
 5
 6
 7
 8
 9 CST-CST-INPE-MCTI-GOV-BR
10
11
12
13
14
15
16
17
18
19 DOP-CPT-INPE-MCTI-GOV-BR
20
21
22
23
24
25
26
27
28 DSR-OBT-INPE-MCTI-GOV-BR
Afiliação 1 University of Leeds
 2 University of Leeds
 3 University of Leeds
 4 Ghent University
 5 Université Paris-Saclay
 6 Technical University Munich
 7 Potsdam Institute for Climate Impact Research (PIK)
 8 Ghent University
 9 Instituto Nacional de Pesquisas Espaciais (INPE)
10 Jardín Botánico de Missouri
11 University of Leeds
12 University of Leeds
13 University of Exeter
14 University of Leeds
15 University of Leeds
16 Instituto Nacional de Pesquisas da Amazônia (INPA)
17 University of Edinburgh
18 Université Paris-Saclay
19 Instituto Nacional de Pesquisas Espaciais (INPE)
20 ALTERRA
21 University of Edinburgh
22 Harvard University
23 University of Oklahoma
24 Fundación Con-Vida
25 Instituto Nacional de Pesquisas da Amazônia (INPA)
26 Instituto Nacional de Pesquisas da Amazônia (INPA)
27 Instituto Nacional de Pesquisas da Amazônia (INPA)
28 Instituto Nacional de Pesquisas Espaciais (INPE)
29 Universidad Autonoma Gabriel Rene Moreno
30 ALTERRA
31 Universidad Autonoma Gabriel Rene Moreno
32 UNELLEZ-Guanare
33 Florida International University
34 Universidade Federal do Acre (UFAC)
35 INRA
36 Tropenbos International
37 Instituto Nacional de Pesquisas da Amazônia (INPA)
38 Université´ Paul Sabatier
39 Jardín Botánico de Medellín Joaquín Antonio Uribe
40 Andes to Amazon Biodiversity Program
41 Universidade Federal do Pará (UFPA)
42 University of Texas at Austin
43 Museu Paraense Emilio Goeldi
44 Instituto Nacional de Pesquisas da Amazônia (INPA)
45 Instituto de Investigaciones de la Amazonía Peruana
46 World Wildlife Fund
47 James Cook University
48 James Cook University
49 Instituto Boliviano de Investigacio´n Forestal
50 International Affairs at George Mason University (GMU)
51 University of Oxford
52 Universidade do Estado de Mato Grosso (UEMT)
53 Universidade do Estado de Mato Grosso (UEMT)
54 9Museu Paraense Emilio Goeldi
55 Escuela de Ciencias Forestales (ESFOR)
56 Universidad Estatal Amazónica
57 Universidad Autonoma del Beni
58 Wageningen University
59 Duke University
60 Wageningen University
61 Universidad Nacional de Colombia
62 Universidad de Los Andes
63 Iwokrama International Centre for Rainforest Conservation and Development
64 Universidad Nacional de Colombia
65 Museu Paraense Emilio Goeldi
66 Universidade Federal do Acre (UFAC)
67 Universidade Federal de Alagoas (UFAL)
68 Naturalis Biodiversity Center
69 Duke University
70 Iwokrama International Centre for Rainforest Conservation and Development
71 Instituto Boliviano de Investigación Forestal
72 Universidad de Los Andes
73 University of Nottingham
74 University of Exeter
75 Museu Paraense Emilio Goeldi
76 Universidad de Los Andes
77 Centro de Investigación y Promoción del Campesinado
78 University of Leeds
Endereço de e-Mail do Autor 1
 2
 3
 4
 5
 6
 7
 8
 9 celso.vonrandow@inpe.br
10
11
12
13
14
15
16
17
18
19 gilvan.sampaio@inpe.br
20
21
22
23
24
25
26
27
28 luiz.aragao@inpe.br
TítuloVariation in stem mortality rates determines patterns of aboveground biomass in Amazonian forests: implications for dynamic global vegetation models
RevistaGlobal Change Biology
Ano2016
Volume22
Palavras-Chaveallometry, carbon, dynamic global vegetation model, forest plots, productivity, tropical forest.
ResumoUnderstanding the processes that determine above-ground biomass (AGB) in Amazonian forests is important for predicting the sensitivity of these ecosystems to environmental change and for designing and evaluating dynamic global vegetation models (DGVMs). AGB is determined by inputs from woody productivity [woody net primary productivity (NPP)] and the rate at which carbon is lost through tree mortality. Here, we test whether two direct metrics of tree mortality (the absolute rate of woody biomass loss and the rate of stem mortality) and/or woody NPP, control variation in AGB among 167 plots in intact forest across Amazonia. We then compare these relationships and the observed variation in AGB and woody NPP with the predictions of four DGVMs. The observations show that stem mortality rates, rather than absolute rates of woody biomass loss, are the most important predictor of AGB, which is consistent with the importance of stand size structure for determining spatial variation in AGB. The relationship between stem mortality rates and AGB varies among different regions of Amazonia, indicating that variation in wood density and height/diameter relationships also influences AGB. In contrast to previous findings, we find that woody NPP is not correlated with stem mortality rates and is weakly positively correlated with AGB. Across the four models, basinwide average AGB is similar to the mean of the observations. However, the models consistently overestimate woody NPP and poorly represent the spatial patterns of both AGB and woody NPP estimated using plot data. In marked contrast to the observations, DGVMs typically show strong positive relationships between woody NPP and AGB. Resolving these differences will require incorporating forest size structure, mechanistic models of stem mortality and variation in functional composition in DGVMs.
Páginas3996-4013
Idiomaen
Tipo SecundárioPRE PI
DivulgaçãoWEBSCI; PORTALCAPES; SCOPUS.
AreaSRE
Nota SecundáriaA1_MEDICINA_I A1_INTERDISCIPLINAR A1_GEOGRAFIA A1_GEOCIÊNCIAS A1_ENGENHARIAS_III A1_CIÊNCIAS_BIOLÓGICAS_I A1_CIÊNCIAS_AMBIENTAIS A1_CIÊNCIAS_AGRÁRIAS_I A1_BIODIVERSIDADE A2_PLANEJAMENTO_URBANO_E_REGIONAL_/_DEMOGRAFIA A2_ASTRONOMIA_/_FÍSICA B1_EDUCAÇÃO C_ENGENHARIAS_II
Tamanho1058 KiB
Número de Arquivos1
Última Atualização2016:12.09.14.34.18 dpi.inpe.br/plutao@80/2008/08.19.15.01 lattes
Última Atualização dos Metadados2018:06.04.23.26.17 dpi.inpe.br/plutao@80/2008/08.19.15.01 administrator {D 2016}
Estágio do Documentoconcluido
É a matriz ou uma cópia?é a matriz
Espelhourlib.net/www/2011/03.29.20.55
e-Mail (login)simone
Grupo de Usuárioslattes
Grupo de Leitoresadministrator
lattes
Visibilidadeshown
Transferível1
Acervo Hospedeirodpi.inpe.br/plutao@80/2008/08.19.15.01
Tipo do ConteudoExternal Contribution
Estágio do Documentonot transferred
Tipo de Versãopublisher
Política de Arquivamentodenypublisher denyfinaldraft
Permissão de Leituradeny from all and allow from 150.163
Unidades Imediatamente Superiores8JMKD3MGPCW/3ER446E
8JMKD3MGPCW/3F3T29H
Conteúdo da Pasta sourcenão têm arquivos
Conteúdo da Pasta agreementnão têm arquivos
Histórico2016-12-05 19:18:32 :: lattes -> administrator ::
2016-12-09 13:08:30 :: administrator -> lattes :: 2016
2016-12-09 14:34:19 :: lattes -> administrator :: 2016
2016-12-09 19:58:53 :: administrator -> lattes :: 2016
2016-12-16 11:21:10 :: lattes -> administrator :: 2016
2018-06-04 23:26:17 :: administrator -> simone :: 2016
Campos Vaziosalternatejournal archivist callnumber copyholder copyright creatorhistory descriptionlevel e-mailaddress format isbn lineage mark month nextedition notes number orcid parameterlist parentrepositories previousedition previouslowerunit progress project rightsholder secondarydate secondarykey session shorttitle sponsor subject targetfile tertiarymark tertiarytype typeofwork url
Data de Acesso19 out. 2020
atualizar 
similares 
Tipo da ReferênciaJournal Article
Identificador8JMKD3MGP3W/3KN33EF
Repositóriosid.inpe.br/plutao/2015/12.04.13.44.37   (acesso restrito)
Metadadossid.inpe.br/plutao/2015/12.04.13.44.38
Siteplutao.sid.inpe.br
DOI10.1016/j.foreco.2015.10.001
Rótulolattes: 1325667605623244 6 AlthoffMCSSOVS:2015:ClChIm
ISSN0378-1127
Código do Detentorisadg {BR SPINPE} ibi 8JMKD3MGPCW/3DT298S
Chave de CitaçãoAlthoffMCSSOVS:2016:ClChIm
Autor1 Althoff, Tiago Diniz
2 Menezes, Rômulo Simões Cezar
3 Carvalho, André Luiz de
4 Siqueira Pinto, Alexandre de
5 Santiago, Gabriela Ayane Chagas Felipe
6 Ometto, Jean Pierre Henry Balbaud
7 Von Randow, Celso
8 Sampaio, Everardo Valadares de Sá Barreto
Grupo1
2
3
4
5
6 CST-CST-INPE-MCTI-GOV-BR
7 CST-CST-INPE-MCTI-GOV-BR
Afiliação1 Universidade Federal de Pernambuco (UFPE)
2 Universidade Federal de Pernambuco (UFPE)
3 Universidade Federal de Pernambuco (UFPE)
4 Universidade Federal de Sergipe (UFS)
5 Universidade Federal de Pernambuco (UFPE)
6 Instituto Nacional de Pesquisas Espaciais (INPE)
7 Instituto Nacional de Pesquisas Espaciais (INPE)
8 Universidade Federal de Pernambuco (UFPE)
Endereço de e-Mail do Autor1
2
3
4
5
6 jean.ometto@inpe.br
7 celso.vonrandow@inpe.br
TítuloClimate change impacts on the sustainability of the firewood harvest and vegetation and soil carbon stocks in a tropical dry forest in Santa Teresinha Municipality, Northeast Brazil
RevistaForest Ecology and Management
Ano2016
Volume360
MêsJan.
Palavras-ChaveCentury model, Forest management, CO2 emissions, Biogeochemical cycling, Semi-arid.
ResumoThe Brazilian semi-arid region is characterized by low and erratic rainfall, high temperatures and high potential evapotranspiration. The removal of firewood from the native tropical dry forest, called Caatinga, can negatively impact important ecosystem services, such as soil conservation, water resources, biodiversity and atmospheric carbon capture, if performed in an unsustainable manner. Most global climate models indicate that Caatinga will experience temperature increases and rainfall decreases in the next few decades. We used the Century model to simulate the impact of climate changes on woody vegetation growth and on vegetation and soil organic carbon stocks in a Caatinga area managed with a single clear cut or cuts every 10 years, 15 years, and 20 years, followed or not followed by the burning of plant residues (leaves and small branches) left after firewood removal. The effects of future climate projections, (LOW, MIDI and HIGH members of the climate scenario SRES A1B, which corresponded to different CO2 emission predictions, downscaled by the Eta/CPTEC model), were compared to those of the projection of the historical climate. With the current climate, it would take 50 years to regenerate the Caatinga biomass stock to a level close to that before cutting after a single cut, followed or not followed by fire. Therefore, the recommended cutting cycles (1020 years) were not long enough to allow for the regeneration of a fully mature Caatinga. However, all of these cycles reached sustainable biomass production levels, with similar total productions until the end of the century. Under these conditions, the lower proportions of biomass recovery of shorter cycles would be compensated by more frequent cutting. The model also indicated that burning or not burning the residues would have little effect. On the contrary, if the climate changes as predicted, the biomass of the native Caatinga vegetation and soil organic carbon stock would decrease throughout this century, even without cutting the vegetation. All of the cutting cycles would not provide sustainable firewood production, with reduced production after each consecutive cut. Therefore, if the climate changes as expected, forest management legislation should require longer periods of forest recovery between cutting cycles for sites with environmental conditions (e.g., climate, soil and vegetation) similar to those of the present study.
Páginas367-375
Idiomaen
Tipo de Trabalhojournal article
Tipo SecundárioPRE PI
DivulgaçãoWEBSCI; PORTALCAPES; COMPENDEX; SCOPUS.
AreaCST
Nota SecundáriaA1_ZOOTECNIA_/_RECURSOS_PESQUEIROS A1_INTERDISCIPLINAR A1_GEOGRAFIA A1_ENGENHARIAS_III A1_CIÊNCIAS_AMBIENTAIS A1_BIODIVERSIDADE A2_GEOCIÊNCIAS A2_ENGENHARIAS_I A2_CIÊNCIAS_AGRÁRIAS_I B1_MATERIAIS B1_ENGENHARIAS_II B1_CIÊNCIAS_BIOLÓGICAS_I B1_BIOTECNOLOGIA
Tamanho2178 KiB
Número de Arquivos1
Arquivo Alvo1_althoff.pdf
Última Atualização2015:12.11.16.29.34 dpi.inpe.br/plutao@80/2008/08.19.15.01 administrator
Última Atualização dos Metadados2018:06.04.23.25.49 dpi.inpe.br/plutao@80/2008/08.19.15.01 administrator {D 2016}
Estágio do Documentoconcluido
É a matriz ou uma cópia?é a matriz
Espelhourlib.net/www/2011/03.29.20.55
e-Mail (login)simone
Grupo de Usuáriosadministrator
lattes
simone
Grupo de Leitoresadministrator
simone
Visibilidadeshown
Transferível1
Acervo Hospedeirodpi.inpe.br/plutao@80/2008/08.19.15.01
Tipo do ConteudoExternal Contribution
Estágio do Documentonot transferred
Tipo de Versãopublisher
Política de Arquivamentodenypublisher denyfinaldraft24
Permissão de Leituradeny from all and allow from 150.163
Unidades Imediatamente Superiores8JMKD3MGPCW/3F3T29H
Conteúdo da Pasta sourcenão têm arquivos
Conteúdo da Pasta agreementnão têm arquivos
Histórico2015-12-04 13:44:38 :: lattes -> administrator ::
2015-12-07 11:19:28 :: administrator -> simone :: 2015
2015-12-11 16:29:34 :: simone -> administrator :: 2015 -> 2016
2018-06-04 23:25:49 :: administrator -> simone :: 2016
Campos Vaziosalternatejournal archivist callnumber copyholder copyright creatorhistory descriptionlevel e-mailaddress format isbn lineage mark nextedition notes number orcid parameterlist parentrepositories previousedition previouslowerunit progress project resumeid rightsholder secondarydate secondarykey session shorttitle sponsor subject tertiarymark tertiarytype url
Data de Acesso19 out. 2020
atualizar 
similares 
Tipo da ReferênciaJournal Article
Identificador8JMKD3MGP3W34P/3MRMT38
Repositóriosid.inpe.br/mtc-m21b/2016/11.23.11.25   (acesso restrito)
Metadadossid.inpe.br/mtc-m21b/2016/11.23.11.25.31
Sitemtc-m21b.sid.inpe.br
DOI10.1016/j.envres.2016.07.035
ISSN0013-9351
Código do Detentorisadg {BR SPINPE} ibi 8JMKD3MGPCW/3DT298S
Chave de CitaçãoAzevedo-SilvaACOCDABMT:2016:MeBiTr
Autor 1 Azevedo-Silva, Claudio Eduardo
 2 Almeida, Ronaldo
 3 Carvalho, Dario P.
 4 Ometto, Jean Pierre Henry Balbaud
 5 Camargo, Plínio B. de
 6 Dorneles, Paulo R.
 7 Azeredo, Antonio
 8 Bastos, Wanderley R.
 9 Malm, Olaf
10 Torres, João P. M.
Grupo 1
 2
 3
 4 CST-CST-INPE-MCTI-GOV-BR
Afiliação 1 Universidade Federal do Rio de Janeiro (UFRJ)
 2 Universidade Federal do Amazonas (UFAM)
 3 Universidade Federal do Rio de Janeiro (UFRJ)
 4 Instituto Nacional de Pesquisas Espaciais (INPE)
 5 Universidade de São Paulo (USP)
 6 Universidade Federal do Rio de Janeiro (UFRJ)
 7 Universidade Federal do Rio de Janeiro (UFRJ)
 8 Universidade Federal de Rondônia (UFRO)
 9 Universidade Federal do Rio de Janeiro (UFRJ)
10 Universidade Federal do Rio de Janeiro (UFRJ)
Endereço de e-Mail do Autor 1
 2
 3
 4 jean.ometto@inpe.br
TítuloMercury biomagnification and the trophic structure of the ichthyofauna from a remote lake in the Brazilian Amazon
RevistaEnvironmental Research
Ano2016
Volume151
MêsNov.
Palavras-ChaveFish, Mercury, Migration, River-floodplain system, Trophic magnification factor.
ResumoThe present study assesses mercury biomagnification and the trophic structure of the ichthyofauna from the Puruzinho Lake, Brazilian Amazon. In addition to mercury determination, the investigation comprised the calculation of Trophic Magnification Factor (TMF) and Trophic Magnification Slope (TMS), through the measurements of stable isotopes of carbon (δ13C) and nitrogen (δ15N) in fish samples. These assessments were executed in two different scenarios, i.e., considering (1) all fish species or (2) only the resident fish (excluding the migratory species). Bottom litter, superficial sediment and seston were the sources used for generating the trophic position (TP) data used in the calculation of the TMF. Samples from 84 fish were analysed, comprising 13 species, which were categorized into four trophic guilds: iliophagous, planktivorous, omnivorous and piscivorous fish. The δ13C values pointed to the separation of the ichthyofauna into two groups. One group comprised iliophagous and planktivorous species, which are linked to the food chains of phytoplankton and detritus. The other group was composed by omnivorous and piscivorous fish, which are associated to the trophic webs of phytoplankton, bottom litter, detritus, periphyton, as well as to food chains of igapó (blackwater-flooded Amazonian forests). The TP values suggest that the ichthyofauna from the Puruzinho Lake is part of a short food web, with three well-characterized trophic levels. Mercury concentrations and δ13C values point to multiple sources for Hg input and transfer. The similarity in Hg levels and TP values between piscivorous and planktivorous fish suggests a comparable efficiency for the transfer of this metal through pelagic and littoral food chains. Regarding the two abovementioned scenarios, i.e., considering (1) the entire ichthyofauna and (2) only the resident species, the TMF values were 5.25 and 4.49, as well as the TMS values were 0.21 and 0.19, respectively. These findings confirm that Hg biomagnifies through the food web of Puruzinho Lake ichthyofauna. The migratory species did not significantly change mercury biomagnification rate in Puruzinho Lake; however, they may play a relevant role in Hg transport. The biomagnification rate (TMS value) in Puruzinho Lake was higher than the average values for its latitude, being comparable to TMS values of temperate and polar systems (marine and freshwater environments).
Páginas286-296
Idiomaen
Tipo de Trabalhojournal article
Tipo SecundárioPRE PI
DivulgaçãoWEBSCI; PORTALCAPES; SCOPUS.
AreaCST
Nota SecundáriaA1_ZOOTECNIA_/_RECURSOS_PESQUEIROS A1_ODONTOLOGIA A1_INTERDISCIPLINAR A1_GEOCIÊNCIAS A1_ENGENHARIAS_III A1_ENFERMAGEM A1_CIÊNCIAS_AMBIENTAIS A2_SAÚDE_COLETIVA A2_QUÍMICA A2_PSICOLOGIA A2_MEDICINA_III A2_MEDICINA_II A2_MEDICINA_I A2_MATERIAIS A2_FARMÁCIA A2_ENGENHARIAS_II A2_CIÊNCIAS_BIOLÓGICAS_II A2_CIÊNCIAS_BIOLÓGICAS_I A2_BIOTECNOLOGIA A2_BIODIVERSIDADE B1_CIÊNCIAS_BIOLÓGICAS_III B2_ENSINO B2_EDUCAÇÃO_FÍSICA B2_ASTRONOMIA_/_FÍSICA C_CIÊNCIAS_AGRÁRIAS_I
Tamanho1319 KiB
Número de Arquivos1
Arquivo Alvoazevedo_mercury.pdf
Última Atualização2016:11.23.11.25.31 sid.inpe.br/mtc-m21b/2013/09.26.14.25.20 simone
Última Atualização dos Metadados2018:06.04.02.41.22 sid.inpe.br/mtc-m21b/2013/09.26.14.25.20 administrator {D 2016}
Estágio do Documentoconcluido
É a matriz ou uma cópia?é a matriz
Espelhourlib.net/www/2011/03.29.20.55
e-Mail (login)simone
Grupo de Usuáriossimone
Grupo de Leitoresadministrator
simone
Visibilidadeshown
Transferível1
Acervo Hospedeirosid.inpe.br/mtc-m21b/2013/09.26.14.25.20
Tipo do ConteudoExternal Contribution
Estágio do Documentonot transferred
Tipo de Versãopublisher
Permissão de Leituradeny from all and allow from 150.163
Unidades Imediatamente Superiores8JMKD3MGPCW/3F3T29H
Conteúdo da Pasta sourcenão têm arquivos
Conteúdo da Pasta agreement
agreement.html 23/11/2016 09:25 1.0 KiB 
Histórico2016-11-23 11:27:09 :: simone -> administrator :: 2016
2018-06-04 02:41:22 :: administrator -> simone :: 2016
Campos Vaziosalternatejournal archivingpolicy archivist callnumber copyholder copyright creatorhistory descriptionlevel e-mailaddress format isbn label lineage mark nextedition notes number orcid parameterlist parentrepositories previousedition previouslowerunit progress project resumeid rightsholder secondarydate secondarykey session shorttitle sponsor subject tertiarymark tertiarytype url
Data de Acesso19 out. 2020
atualizar 
similares 
Tipo da ReferênciaJournal Article
Identificador8JMKD3MGP3W34P/3MRK6AE
Repositóriosid.inpe.br/mtc-m21b/2016/11.22.20.17
Metadadossid.inpe.br/mtc-m21b/2016/11.22.20.17.47
Sitemtc-m21b.sid.inpe.br
DOI10.1371/journal.pone.0165073
ISSN1932-6203
Código do Detentorisadg {BR SPINPE} ibi 8JMKD3MGPCW/3DT298S
Chave de CitaçãoRibeiroSaleMarcLoyo:2016:AsMaEx
Autor1 Ribeiro, Bruno R.
2 Sales, Lilian P.
3 Marco Júnior, Paulo de
4 Loyola, Rafael
Grupo1
2
3 CST-CST-INPE-MCTI-GOV-BR
4 CST-CST-INPE-MCTI-GOV-BR
Afiliação1 Universidade Federal de Goiás (UFGO)
2 Universidade Federal de Goiás (UFGO)
3 Instituto Nacional de Pesquisas Espaciais (INPE)
4 Instituto Nacional de Pesquisas Espaciais (INPE)
Endereço de e-Mail do Autor1
2
3 pdemarco@pq.cnpq.br
4 loyola@ufg.br
TítuloAssessing mammal exposure to climate change in the Brazilian Amazon
RevistaPLoS ONE
Ano2016
Volume11
Número11
MêsNov.
ResumoHuman-induced climate change is considered a conspicuous threat to biodiversity in the 21st century. Species' response to climate change depends on their exposition, sensitivity and ability to adapt to novel climates. Exposure to climate change is however uneven within species' range, so that some populations may be more at risk than others. Identifying the regions most exposed to climate change is therefore a first and pivotal step on determining species' vulnerability across their geographic ranges. Here, we aimed at quantifying mammal local exposure to climate change across species' ranges. We identified areas in the Brazilian Amazon where mammals will be critically exposed to non-analogue climates in the future with different variables predicted by 15 global circulation climate forecasts. We also built a null model to assess the effectiveness of the Amazon protected areas in buffering the effects of climate change on mammals, using an innovative and more realistic approach. We found that 85% of species are likely to be exposed to non-analogue climatic conditions in more than 80% of their ranges by 2070. That percentage is even higher for endemic mammals; almost all endemic species are predicted to be exposed in more than 80% of their range. Exposure patterns also varied with different climatic variables and seem to be geographically structured. Western and northern Amazon species are more likely to experience temperature anomalies while northeastern species will be more affected by rainfall abnormality. We also observed an increase in the number of critically-exposed species from 2050 to 2070. Overall, our results indicate that mammals might face high exposure to climate change and that protected areas will probably not be efficient enough to avert those impacts.
Idiomaen
Tipo de Trabalhojournal article
Tipo SecundárioPRE PI
DivulgaçãoWEBSCI
AreaCST
Nota SecundáriaA1_ZOOTECNIA_/_RECURSOS_PESQUEIROS A1_SAÚDE_COLETIVA A1_QUÍMICA A1_ODONTOLOGIA A1_NUTRIÇÃO A1_MEDICINA_VETERINÁRIA A1_MEDICINA_III A1_MEDICINA_II A1_MEDICINA_I A1_INTERDISCIPLINAR A1_GEOGRAFIA A1_GEOCIÊNCIAS A1_FARMÁCIA A1_ENGENHARIAS_III A1_ENGENHARIAS_I A1_ENFERMAGEM A1_EDUCAÇÃO_FÍSICA A1_CIÊNCIAS_AMBIENTAIS A1_CIÊNCIAS_AGRÁRIAS_I A1_CIÊNCIA_DE_ALIMENTOS A1_CIÊNCIA_DA_COMPUTAÇÃO A1_BIOTECNOLOGIA A1_BIODIVERSIDADE A1_ADMINISTRAÇÃO,_CIÊNCIAS_CONTÁBEIS_E_TURISMO A2_PSICOLOGIA A2_PLANEJAMENTO_URBANO_E_REGIONAL_/_DEMOGRAFIA A2_MATERIAIS A2_MATEMÁTICA_/_PROBABILIDADE_E_ESTATÍSTICA A2_ENGENHARIAS_IV A2_ECONOMIA A2_CIÊNCIAS_BIOLÓGICAS_III A2_CIÊNCIAS_BIOLÓGICAS_II A2_CIÊNCIAS_BIOLÓGICAS_I A2_ASTRONOMIA_/_FÍSICA B1_EDUCAÇÃO B3_SERVIÇO_SOCIAL B3_LETRAS_/_LINGUÍSTICA B3_CIÊNCIAS_SOCIAIS_APLICADAS_I B3_ANTROPOLOGIA_/_ARQUEOLOGIA C_ENGENHARIAS_II
Tamanho1521 KiB
Número de Arquivos1
Arquivo Alvoribeiro_assessing.PDF
Última Atualização2016:11.22.20.17.47 sid.inpe.br/mtc-m21b/2013/09.26.14.25.20 simone
Última Atualização dos Metadados2018:06.04.02.41.22 sid.inpe.br/mtc-m21b/2013/09.26.14.25.20 administrator {D 2016}
Estágio do Documentoconcluido
É a matriz ou uma cópia?é a matriz
Espelhourlib.net/www/2011/03.29.20.55
e-Mail (login)simone
Grupo de Usuáriossimone
Grupo de Leitoresadministrator
simone
Visibilidadeshown
Transferível1
Acervo Hospedeirosid.inpe.br/mtc-m21b/2013/09.26.14.25.20
Tipo do ConteudoExternal Contribution
Estágio do Documentonot transferred
Tipo de Versãopublisher
Política de Arquivamentoallowpublisher allowfinaldraft
Unidades Imediatamente Superiores8JMKD3MGPCW/3F3T29H
Conteúdo da Pasta sourcenão têm arquivos
Conteúdo da Pasta agreement
agreement.html 22/11/2016 18:17 1.0 KiB 
Histórico2016-11-22 20:17:47 :: simone -> administrator ::
2016-11-22 20:17:48 :: administrator -> simone :: 2016
2016-11-22 20:18:21 :: simone -> administrator :: 2016
2018-06-04 02:41:22 :: administrator -> simone :: 2016
Campos Vaziosalternatejournal archivist callnumber copyholder copyright creatorhistory descriptionlevel e-mailaddress format isbn keywords label lineage mark nextedition notes orcid pages parameterlist parentrepositories previousedition previouslowerunit progress project readpermission resumeid rightsholder secondarydate secondarykey session shorttitle sponsor subject tertiarymark tertiarytype url
Data de Acesso19 out. 2020
atualizar 
similares 
Tipo da ReferênciaJournal Article
Identificador8JMKD3MGP3W34P/3MRK3J5
Repositóriosid.inpe.br/mtc-m21b/2016/11.22.19.44   (acesso restrito)
Metadadossid.inpe.br/mtc-m21b/2016/11.22.19.44.43
Sitemtc-m21b.sid.inpe.br
DOI10.1080/15481603.2016.1228161
ISSN1548-1603
Código do Detentorisadg {BR SPINPE} ibi 8JMKD3MGPCW/3DT298S
Chave de CitaçãoMateusBorSilNicCat:2016:CaStAb
Autor1 Mateus, Pedro
2 Borma, Laura de Simone
3 Silva, Ricardo Dal'Agnol da
4 Nico, Giovanni
5 Catalão, João
Grupo1 CST-CST-INPE-MCTI-GOV-BR
2 CST-CST-INPE-MCTI-GOV-BR
3 CST-CST-INPE-MCTI-GOV-BR
Afiliação1 Instituto Nacional de Pesquisas Espaciais (INPE)
2 Instituto Nacional de Pesquisas Espaciais (INPE)
3 Instituto Nacional de Pesquisas Espaciais (INPE)
4 Consiglio Nazionale delle Ricerche
5 University of Lisbon
Endereço de e-Mail do Autor1 pedro.mateus@inpe.br
2 laura.borma@inpe.br
3 ricardo.silva@inpe.br
TítuloAssessment of two techniques to merge ground-based and TRMM rainfall measurements: a case study about Brazilian Amazon Rainforest
RevistaGIScience and Remote Sensing
Ano2016
Volume53
Número6
MêsNov.
Palavras-Chavebias correction, rainfall interpolation, remote sensing, statistical data merging, TRMM.
ResumoThe availability of accurate rainfall data with high spatial resolution, especially in vast watersheds with low density of ground-measurements, is critical for planning and management of water resources and can increase the quality of the hydrological modeling predictions. In this study, we used two classical methods: the optimal interpolation and the successive correction method (SCM), for merging ground-measurements and satellite rainfall estimates. Cressman and Barnes schemes have been used in the SCM in order to define the error covariance matrices. The correction of bias in satellite rainfall data has been assessed by using four different algorithms: (1) the mean bias correction, (2) the regression equation, (3) the distribution transformation, and (4) the spatial transformation. The satellite rainfall data were provided by the Tropical Rainfall Measuring Mission, over the Brazilian Amazon Rainforest. Performances of the two merging data techniques are compared, qualitatively, by visual inspection and quantitatively, by a statistical analysis, collected from January 1999 to December 2010. The computation of the statistical indices shows that the SCM, with the Cressman scheme, provides slightly better results.
Páginas689-706
Idiomaen
Tipo de Trabalhojournal article
Tipo SecundárioPRE PI
DivulgaçãoWEBSCI
AreaCST
Nota SecundáriaB1_GEOCIÊNCIAS B1_CIÊNCIAS_AGRÁRIAS_I B2_INTERDISCIPLINAR B3_CIÊNCIAS_AMBIENTAIS
Tamanho1317 KiB
Número de Arquivos1
Última Atualização2017:07.21.16.29.14 sid.inpe.br/mtc-m21b/2013/09.26.14.25.20 simone
Última Atualização dos Metadados2018:06.04.02.41.21 sid.inpe.br/mtc-m21b/2013/09.26.14.25.20 administrator {D 2016}
Estágio do Documentoconcluido
É a matriz ou uma cópia?é a matriz
Espelhourlib.net/www/2011/03.29.20.55
e-Mail (login)simone
Grupo de Usuáriossimone
Grupo de Leitoresadministrator
simone
Visibilidadeshown
Transferível1
Acervo Hospedeirosid.inpe.br/mtc-m21b/2013/09.26.14.25.20
Tipo do ConteudoExternal Contribution
Estágio do Documentonot transferred
Tipo de Versãopublisher
Política de Arquivamentodenypublisher denyfinaldraft
Permissão de Leituradeny from all and allow from 150.163
Unidades Imediatamente Superiores8JMKD3MGPCW/3F3T29H
Conteúdo da Pasta sourcenão têm arquivos
Conteúdo da Pasta agreement
agreement.html 22/11/2016 17:44 1.0 KiB 
Histórico2016-11-22 19:44:43 :: simone -> administrator ::
2016-11-22 19:44:44 :: administrator -> simone :: 2016
2016-11-22 19:45:27 :: simone -> administrator :: 2016
2016-11-23 15:06:57 :: administrator -> simone :: 2016
2016-12-20 18:36:08 :: simone -> administrator :: 2016
2017-01-09 13:59:35 :: administrator -> simone :: 2016
2017-07-21 16:29:14 :: simone -> administrator :: 2016
2018-06-04 02:41:21 :: administrator -> simone :: 2016
Campos Vaziosalternatejournal archivist callnumber copyholder copyright creatorhistory descriptionlevel e-mailaddress format isbn label lineage mark nextedition notes orcid parameterlist parentrepositories previousedition previouslowerunit progress project resumeid rightsholder secondarydate secondarykey session shorttitle sponsor subject targetfile tertiarymark tertiarytype url
Data de Acesso19 out. 2020
atualizar 
similares 
Tipo da ReferênciaJournal Article
Identificador8JMKD3MGP3W34P/3MRJSS5
Repositóriosid.inpe.br/mtc-m21b/2016/11.22.18.59
Metadadossid.inpe.br/mtc-m21b/2016/11.22.18.59.29
Sitemtc-m21b.sid.inpe.br
DOI10.5194/hess-20-4237-2016
ISSN1027-5606
Código do Detentorisadg {BR SPINPE} ibi 8JMKD3MGPCW/3DT298S
Chave de CitaçãoMallickTBGSDHVKASEDONMHMW:2016:CaBiCo
Autor 1 Mallick, Kaniska
 2 Trebs, Ivonne
 3 Boegh, Eva
 4 Giustarini, Laura
 5 Schlerf, Martin
 6 Drewry, Darren T.
 7 Hoffmann, Lucien
 8 Von Randow, Celso
 9 Kruijt, Bart
10 Araùjo, Alessandro
11 Saleska, Scott
12 Ehleringer, James R.
13 Domingues, Tomas F.
14 Ometto, Jean Pierre Henry Balbaud
15 Nobre, Antonio Donato
16 Moraes, Osvaldo Luiz Leal de
17 Hayek, Matthew
18 Munger, J. William
19 Wofsy, Steven C.
Grupo 1
 2
 3
 4
 5
 6
 7
 8 CST-CST-INPE-MCTI-GOV-BR
 9
10
11
12
13
14 CST-CST-INPE-MCTI-GOV-BR
15 CST-CST-INPE-MCTI-GOV-BR
Afiliação 1 Luxembourg Institute of Science and Technology (LIST)
 2 Luxembourg Institute of Science and Technology (LIST)
 3 Roskilde University
 4 Luxembourg Institute of Science and Technology (LIST)
 5 Luxembourg Institute of Science and Technology (LIST)
 6 Jet Propulsion Laboratory
 7 Luxembourg Institute of Science and Technology (LIST)
 8 Instituto Nacional de Pesquisas Espaciais (INPE)
 9 Luxembourg Institute of Science and Technology (LIST)
10 Empresa Brasileira de Pesquisa Agropecuária (EMBRAPA)
11 University of Arizona
12 University of Utah
13 Universidade de Saõ Paulo (USP)
14 Instituto Nacional de Pesquisas Espaciais (INPE)
15 Instituto Nacional de Pesquisas Espaciais (INPE)
16 Centro Nacional de Monitoramento e Alertas de Desastres Naturais (CEMADEN)
17 Harvard University
18 Harvard University
19 Harvard University
Endereço de e-Mail do Autor 1
 2
 3
 4
 5
 6
 7
 8 celso.vonrandow@inpe.br
 9
10
11
12
13
14 jean.ometto@inpe.br
15 anobre27@ yahoo.com
TítuloCanopy-scale biophysical controls of transpiration and evaporation in the Amazon Basin
RevistaHydrology and Earth System Sciences
Ano2016
Volume20
Número10
MêsOct.
ResumoCanopy and aerodynamic conductances (gC and gA) are two of the key land surface biophysical variables that control the land surface response of land surface schemes in climate models. Their representation is crucial for predicting transpiration (λET) and evaporation (λEE) flux components of the terrestrial latent heat flux (λE), which has important implications for global climate change and water resource management. By physical integration of radiometric surface temperature (TR) into an integrated framework of the Penman-Monteith and Shuttleworth-Wallace models, we present a novel approach to directly quantify the canopy-scale biophysical controls on λET and λEE over multiple plant functional types (PFTs) in the Amazon Basin. Combining data from six LBA (Large-scale Biosphere-Atmosphere Experiment in Amazonia) eddy covariance tower sites and a TR-driven physically based modeling approach, we identified the canopy-scale feedback-response mechanism between gC, λET, and atmospheric vapor pressure deficit (DA), without using any leaf-scale empirical parameterizations for the modeling. The TR-based model shows minor biophysical control on λET during the wet (rainy) seasons where λET becomes predominantly radiation driven and net radiation (RN) determines 75 to 80% of the variances of λET. However, biophysical control on λET is dramatically increased during the dry seasons, and particularly the 2005 drought year, explaining 50 to 65% of the variances of λET, and indicates λET to be substantially soil moisture driven during the rainfall deficit phase. Despite substantial differences in gA between forests and pastures, very similar canopy-atmosphere "coupling" was found in these two biomes due to soil moisture-induced decrease in gC in the pasture. This revealed the pragmatic aspect of the TR-driven model behavior that exhibits a high sensitivity of gC to per unit change in wetness as opposed to gA that is marginally sensitive to surface wetness variability. Our results reveal the occurrence of a significant hysteresis between λET and gC during the dry season for the pasture sites, which is attributed to relatively low soil water availability as compared to the rainforests, likely due to differences in rooting depth between the two systems. Evaporation was significantly influenced by gA for all the PFTs and across all wetness conditions. Our analytical framework logically captures the responses of gC and gA to changes in atmospheric radiation, DA, and surface radiometric temperature, and thus appears to be promising for the improvement of existing land-surface-atmosphere exchange parameterizations across a range of spatial scales.
Páginas4237-4264
Idiomaen
Tipo de Trabalhojournal article
Tipo SecundárioPRE PI
DivulgaçãoWEBSCI; PORTALCAPES.
AreaCST
Nota SecundáriaA1_GEOGRAFIA A1_ENGENHARIAS_I A1_CIÊNCIAS_AGRÁRIAS_I A2_INTERDISCIPLINAR A2_GEOCIÊNCIAS A2_CIÊNCIAS_BIOLÓGICAS_I A2_CIÊNCIAS_AMBIENTAIS B1_BIODIVERSIDADE B2_ARQUITETURA_E_URBANISMO
Tamanho6753 KiB
Número de Arquivos1
Arquivo Alvomallick_canopy.pdf
Última Atualização2016:11.22.18.59.29 sid.inpe.br/mtc-m21b/2013/09.26.14.25.20 simone
Última Atualização dos Metadados2018:06.04.02.41.21 sid.inpe.br/mtc-m21b/2013/09.26.14.25.20 administrator {D 2016}
Estágio do Documentoconcluido
É a matriz ou uma cópia?é a matriz
Espelhourlib.net/www/2011/03.29.20.55
e-Mail (login)simone
Grupo de Usuáriossimone
Grupo de Leitoresadministrator
simone
Visibilidadeshown
Transferível1
Acervo Hospedeirosid.inpe.br/mtc-m21b/2013/09.26.14.25.20
Tipo do ConteudoExternal Contribution
Estágio do Documentonot transferred
Tipo de Versãopublisher
Política de Arquivamentoallowpublisher allowfinaldraft
Unidades Imediatamente Superiores8JMKD3MGPCW/3F3T29H
Conteúdo da Pasta sourcenão têm arquivos
Conteúdo da Pasta agreement
agreement.html 22/11/2016 16:59 1.0 KiB 
Histórico2016-11-22 18:59:29 :: simone -> administrator ::
2016-11-22 18:59:30 :: administrator -> simone :: 2016
2016-11-22 19:02:10 :: simone -> administrator :: 2016
2018-06-04 02:41:21 :: administrator -> simone :: 2016
Campos Vaziosalternatejournal archivist callnumber copyholder copyright creatorhistory descriptionlevel e-mailaddress format isbn keywords label lineage mark nextedition notes orcid parameterlist parentrepositories previousedition previouslowerunit progress project readpermission resumeid rightsholder secondarydate secondarykey session shorttitle sponsor subject tertiarymark tertiarytype url
Data de Acesso19 out. 2020
atualizar 
similares 
Tipo da ReferênciaJournal Article
Identificador8JMKD3MGP3W34P/3MRJPG2
Repositóriosid.inpe.br/mtc-m21b/2016/11.22.18.18
Metadadossid.inpe.br/mtc-m21b/2016/11.22.18.18.28
Sitemtc-m21b.sid.inpe.br
DOI10.3390/ijerph13100947
ISSN1661-7827
1660-4601
Código do Detentorisadg {BR SPINPE} ibi 8JMKD3MGPCW/3DT298S
Chave de CitaçãoFerreiraFoFrNaJuGo:2016:EfPaMa
Autor1 Ferreira, Tatiane Morais
2 Forti, Maria Cristina
3 Freitas, Clarice Umbelino de
4 Nascimento, Felipe Parra
5 Junger, Washington Leite
6 Gouveia, Nelson
Identificador de Curriculo1
2 8JMKD3MGP5W/3C9JHR6
Grupo1
2 CST-CST-INPE-MCTI-GOV-BR
Afiliação1 Universidade de São Paulo (USP)
2 Instituto Nacional de Pesquisas Espaciais (INPE)
3 Universidade de São Paulo (USP)
4 Universidade de São Paulo (USP)
5 Universidade Estadual do Rio de Janeiro (UERJ)
6 Universidade de São Paulo (USP)
Endereço de e-Mail do Autor1
2 cristina.forti@inpe.br
TítuloEffects of particulate matter and its chemical constituents on elderly hospital admissions due to circulatory and respiratory diseases
RevistaInternational Journal of Environmental Research and Public Health
Ano2016
Volume13
Número10
MêsOct.
Palavras-ChaveAir pollution, Chemical constituents, Hospital admission, Particulate matter, Time series.
ResumoVarious fractions of particulate matter have been associated with increased mortality and morbidity. The purpose of our study is to analyze the associations between concentrations of PM2.5, PM2.5-10, PM10 and their chemical constituents (soluble ions) with hospital admissions due to circulatory and respiratory diseases among the elderly in a medium-sized city in Brazil. A time series study was conducted using Poisson regression with generalized additive models adjusted for confounders. Statistically significant associations were identified between PM10 and PM2.5-10 and respiratory diseases. Risks of hospitalization increased by 23.5% (95% CI: 13.5; 34.3) and 12.8% (95% CI: 6.0; 20.0) per 10 μg/m3 of PM2.5-10 and PM10, respectively. PM2.5 exhibited a significant association with circulatory system diseases, with the risk of hospitalization increasing by 19.6% (95% CI: 6.4; 34.6) per 10 μg/m3. Regarding the chemical species; SO4 2-, NO3 -, NH4 + and K+ exhibited specific patterns of risk, relative to the investigated outcomes. Overall, SO4 2- in PM2.5-10 and K+ in PM2.5 were associated with increased risk of hospital admissions due to both types of diseases. The results agree with evidence indicating that the risks for different health outcomes vary in relation to the fractions and chemical composition of PM10. Thus, PM10 speciation studies may contribute to the establishment of more selective pollution control policies.
Páginas947
Idiomaen
Tipo de Trabalhojournal article
Tipo SecundárioPRE PI
DivulgaçãoWEBSCI
AreaCST
Nota SecundáriaA2_INTERDISCIPLINAR A2_CIÊNCIAS_AGRÁRIAS_I B1_SAÚDE_COLETIVA B1_ODONTOLOGIA B1_NUTRIÇÃO B1_MEDICINA_III B1_MEDICINA_II B1_GEOCIÊNCIAS B1_ENFERMAGEM B1_EDUCAÇÃO_FÍSICA B2_FARMÁCIA B2_CIÊNCIAS_BIOLÓGICAS_II B3_CIÊNCIAS_AMBIENTAIS
Tamanho1274 KiB
Número de Arquivos1
Arquivo Alvoferreira_effects.pdf
Última Atualização2016:11.22.18.18.28 sid.inpe.br/mtc-m21b/2013/09.26.14.25.20 simone
Última Atualização dos Metadados2018:06.04.02.41.21 sid.inpe.br/mtc-m21b/2013/09.26.14.25.20 administrator {D 2016}
Estágio do Documentoconcluido
É a matriz ou uma cópia?é a matriz
Espelhourlib.net/www/2011/03.29.20.55
e-Mail (login)simone
Grupo de Usuáriossimone
Grupo de Leitoresadministrator
simone
Visibilidadeshown
Transferível1
Acervo Hospedeirosid.inpe.br/mtc-m21b/2013/09.26.14.25.20
Tipo do ConteudoExternal Contribution
Estágio do Documentonot transferred
Tipo de Versãopublisher
Política de Arquivamentoallowpublisher allowfinaldraft
Unidades Imediatamente Superiores8JMKD3MGPCW/3F3T29H
Conteúdo da Pasta sourcenão têm arquivos
Conteúdo da Pasta agreement
agreement.html 22/11/2016 16:18 1.0 KiB 
Histórico2016-11-22 18:18:28 :: simone -> administrator ::
2016-11-22 18:18:28 :: administrator -> simone :: 2016
2016-11-22 18:19:18 :: simone -> administrator :: 2016
2018-06-04 02:41:21 :: administrator -> simone :: 2016
Campos Vaziosalternatejournal archivist callnumber copyholder copyright creatorhistory descriptionlevel e-mailaddress format isbn label lineage mark nextedition notes orcid parameterlist parentrepositories previousedition previouslowerunit progress project readpermission rightsholder secondarydate secondarykey session shorttitle sponsor subject tertiarymark tertiarytype url
Data de Acesso19 out. 2020
atualizar 
similares 
Tipo da ReferênciaJournal Article
Identificador8JMKD3MGP3W34P/3MREALP
Repositóriosid.inpe.br/mtc-m21b/2016/11.21.17.50
Metadadossid.inpe.br/mtc-m21b/2016/11.21.17.50.15
Sitemtc-m21b.sid.inpe.br
DOI10.1175/2016BAMSStateoftheClimate.1
ISSN0003-0007
Código do Detentorisadg {BR SPINPE} ibi 8JMKD3MGPCW/3DT298S
Chave de CitaçãoAaron-MorrisonAAAAAAAAAAAAAAABBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBC:2016:StCl20
Autor 1 Aaron-Morrison, A. P.
 2 Ackerman, S. A.
 3 Adams, N. G.
 4 Adler, R. F.
 5 Albanil, A.
 6 Alfaro, E. J.
 7 Allan, R.
 8 Alves, Lincoln Muniz
 9 Amador, J. A.
10 Andreassen, L. M.
11 Arendt, A.
12 Arévalo, J.
13 Arndt, D. S.
14 Arzhanova, N. M.
15 Aschan, M. M.
16 Azorin-Molina, C.
17 Banzon, V.
18 Bardin, M. U.
19 Barichivich, J.
20 Baringer, M. O.
21 Barreira, S.
22 Baxter, S.
23 Bazo, J.
24 Becker, A.
25 Bedka, K. M.
26 Behrenfeld, M. J.
27 Bell, G. D.
28 Belmont, M.
29 Benedetti, A.
30 Bernhard, G.
31 Berrisford, P.
32 Berry, D. I.
33 Bettolli, M. L.
34 Bhatt, U. S.
35 Bidegain, M.
36 Bill, B. D.
37 Billheimer, S.
38 Bissolli, P.
39 Blake, E. S.
40 Blunden, J.
41 Bosilovich, M. G.
42 Boucher, O.
43 Boudet, D.
44 Box, J. E.
45 Boyer, T.
46 Braathen, G. O.
47 Bromwich, D. H.
48 Brown, R.
49 Bulygina, O. N.
50 Burgess, D.
51 Calderón, B.
Grupo 1
 2
 3
 4
 5
 6
 7
 8 CST-CST-INPE-MCTI-GOV-BR
Afiliação 1
 2
 3
 4
 5
 6
 7
 8 Instituto Nacional de Pesquisas Espaciais (INPE)
Endereço de e-Mail do Autor 1
 2
 3
 4
 5
 6
 7
 8 lincoln.alves@inpe.br
TítuloState of the climate in 2015
RevistaBulletin of the American Meteorological Society
Ano2016
Volume97
Número8
MêsAug.
Palavras-ChaveAgriculture, Atmospheric temperature, Carbon dioxide, Carbon monoxide, Digital storage, Drought, Earth atmosphere, Fisheries, Greenhouse gases, Groundwater, Hurricanes, Nickel, Nitrogen oxides, Oceanography, Ozone, Ozone layer, Precipitation (meteorology), Rain, Sea ice, Sea level, Snow, Soil moisture, Storms, Submarine geophysics, Surface measurement, Surface properties, Surface waters, Tropics, Water conservation.
ResumoIn 2015, the dominant greenhouse gases released into Earths atmospherecarbon dioxide, methane, and nitrous oxideall continued to reach new high levels. At Mauna Loa, Hawaii, the annual CO2 concentration increased by a record 3.1 ppm, exceeding 400 ppm for the first time on record. The 2015 global CO2 average neared this threshold, at 399.4 ppm. Additionally, one of the strongest El Niño events since at least 1950 developed in spring 2015 and continued to evolve through the year. The phenomenon was far reaching, impacting many regions across the globe and affecting most aspects of the climate system. Owing to the combination of El Niño and a long-term upward trend, Earth observed record warmth for the second consecutive year, with the 2015 annual global surface temperature surpassing the previous record by more than 0.1°C and exceeding the average for the mid- to late 19th centurycommonly considered representative of preindustrial conditionsby more than 1°C for the first time. Above Earths surface, lower troposphere temperatures were near-record high. Across land surfaces, record to near-record warmth was reported across every inhabited continent. Twelve countries, including Russia and China, reported record high annual temperatures. In June, one of the most severe heat waves since 1980 affected Karachi, Pakistan, claiming over 1000 lives. On 27 October, Vredendal, South Africa, reached 48.4°C, a new global high temperature record for this month. In the Arctic, the 2015 land surface temperature was 1.2°C above the 19812010 average, tying 2007 and 2011 for the highest annual temperature and representing a 2.8°C increase since the record began in 1900. Increasing temperatures have led to decreasing Arctic sea ice extent and thickness. On 25 February 2015, the lowest maximum sea ice extent in the 37-year satellite record was observed, 7% below the 19812010 average. Mean sea surface temperatures across the Arctic Ocean during August in ice-free regions, representative of Arctic Ocean summer anomalies, ranged from ~0°C to 8°C above average. As a consequence of sea ice retreat and warming oceans, vast walrus herds in the Pacific Arctic are hauling out on land rather than on sea ice, raising concern about the energetics of females and young animals. Increasing temperatures in the Barents Sea are linked to a community-wide shift in fish populations: boreal communities are now farther north, and long-standing Arctic species have been almost pushed out of the area. Above average sea surface temperatures are not confined to the Arctic. Sea surface temperature for 2015 was record high at the global scale; however, the North Atlantic southeast of Greenland remained colder than average and colder than 2014. Global annual ocean heat content and mean sea level also reached new record highs. The Greenland Ice Sheet, with the capacity to contribute ~7 m to sea level rise, experienced melting over more than 50% of its surface for the first time since the record melt of 2012. Other aspects of the cryosphere were remarkable. Alpine glacier retreat continued, and preliminary data indicate that 2015 is the 36th consecutive year of negative annual mass balance. Across the Northern Hemisphere, late-spring snow cover extent continued its trend of decline, with June the second lowest in the 49-year satellite record. Below the surface, record high temperatures at 20-m depth were measured at all permafrost observatories on the North Slope of Alaska, increasing by up to 0.66°C decade1 since 2000. In the Antarctic, surface pressure and temperatures were lower than the 19812010 average for most of the year, consistent with the primarily positive southern annular mode, which saw a record high index value of +4.92 in February. Antarctic sea ice extent and area had large intra-annual variability, with a shift from record high levels in May to record low levels in August. Springtime ozone depletion resulted in one of the largest and most persistent Antarctic ozone holes observed since the 1990s. Closer to the equator, 101 named tropical storms were observed in 2015, well above the 19812010 average of 82. The eastern/central Pacific had 26 named storms, the most since 1992. The western north Pacific and north and south Indian Ocean basins also saw high activity. Globally, eight tropical cyclones reached the SaffirSimpson Category 5 intensity level. Overlaying a general increase in the hydrologic cycle, the strong El Niño enhanced precipitation variability around the world. An above-normal rainy season led to major floods in Paraguay, Bolivia, and southern Brazil. In May, the United States recorded its all-time wettest month in its 121-year national record. Denmark and Norway reported their second and third wettest year on record, respectively, but globally soil moisture was below average, terrestrial groundwater storage was the lowest in the 14-year record, and areas in severe drought rose from 8% in 2014 to 14% in 2015. Drought conditions prevailed across many Caribbean island nations, Colombia, Venezuela, and northeast Brazil for most of the year. Several South Pacific countries also experienced drought. Lack of rainfall across Ethiopia led to its worst drought in decades and affected millions of people, while prolonged drought in South Africa severely affected agricultural production. Indian summer monsoon rainfall was just 86% of average. Extremely dry conditions in Indonesia resulted in intense and widespread fires during AugustNovember that produced abundant carbonaceous aerosols, carbon monoxide, and ozone. Overall, emissions from tropical Asian biomass burning in 2015 were almost three times the 200114 average.
PáginasS1-S275
Idiomaen
Tipo de Trabalhojournal article
Tipo SecundárioPRE PI
DivulgaçãoWEBSCI; PORTALCAPES; MGA; COMPENDEX.
AreaCST
Nota SecundáriaA1_INTERDISCIPLINAR A1_GEOCIÊNCIAS A1_ENGENHARIAS_III A1_CIÊNCIAS_AMBIENTAIS A1_BIODIVERSIDADE
Tamanho17796 KiB
Número de Arquivos1
Arquivo Alvoaaron_state.pdf
Última Atualização2016:11.21.17.50.15 sid.inpe.br/mtc-m21b/2013/09.26.14.25.20 administrator
Última Atualização dos Metadados2018:06.04.02.41.20 sid.inpe.br/mtc-m21b/2013/09.26.14.25.20 administrator {D 2016}
Estágio do Documentoconcluido
É a matriz ou uma cópia?é a matriz
Espelhourlib.net/www/2011/03.29.20.55
e-Mail (login)simone
Grupo de Usuáriossimone
Grupo de Leitoresadministrator
simone
Visibilidadeshown
Transferível1
Acervo Hospedeirosid.inpe.br/mtc-m21b/2013/09.26.14.25.20
Tipo do ConteudoExternal Contribution
Estágio do Documentonot transferred
Tipo de Versãopublisher
Política de Arquivamentodenypublisher6 allowfinaldraft
Permissão de Leituraallow from all
Unidades Imediatamente Superiores8JMKD3MGPCW/3F3T29H
Conteúdo da Pasta sourcenão têm arquivos
Conteúdo da Pasta agreement
agreement.html 21/11/2016 15:50 1.0 KiB 
Histórico2016-11-21 17:50:15 :: simone -> administrator ::
2016-11-21 17:51:05 :: administrator -> simone :: 2016
2016-11-23 14:32:16 :: simone -> administrator :: 2016
2018-06-04 02:41:20 :: administrator -> simone :: 2016
Campos Vaziosalternatejournal archivist callnumber copyholder copyright creatorhistory descriptionlevel e-mailaddress format isbn label lineage mark nextedition notes orcid parameterlist parentrepositories previousedition previouslowerunit progress project resumeid rightsholder secondarydate secondarykey session shorttitle sponsor subject tertiarymark tertiarytype url
Data de Acesso19 out. 2020
atualizar 
Tipo da ReferênciaJournal Article
Identificador8JMKD3MGP3W34P/3MQ9E9L
Repositóriosid.inpe.br/mtc-m21b/2016/11.14.11.36   (acesso restrito)
Metadadossid.inpe.br/mtc-m21b/2016/11.14.11.36.55
Sitemtc-m21b.sid.inpe.br
DOI10.1016/j.palaeo.2016.08.032
ISSN0031-0182
Código do Detentorisadg {BR SPINPE} ibi 8JMKD3MGPCW/3DT298S
Chave de CitaçãoSallesPTGRSOHCS:2016:QuCaSt
Autor 1 Salles, Leandro O.
 2 Perini, Fernando A.
 3 Toledo, Peter Mann de
 4 Guedes, Patricia G.
 5 Ramos, Renato R. C.
 6 Strikis, Nicolas M.
 7 Oliveira, Luiz Flamarion B.
 8 Hofmann, Gabriel S.
 9 Calvo, Emilio M.
10 Stafford Junior, Thomas W.
Identificador de Curriculo 1
 2
 3 8JMKD3MGP5W/3C9JJ46
Grupo 1
 2
 3 CST-CST-INPE-MCTI-GOV-BR
Afiliação 1 Universidade Federal do Rio de Janeiro (UFRJ)
 2 Universidade Federal de Minas Gerais (UFMG)
 3 Instituto Nacional de Pesquisas Espaciais (INPE)
 4 Universidade Federal do Rio de Janeiro (UFRJ)
 5 Universidade Federal do Rio de Janeiro (UFRJ)
 6 Universidade Federal Fluminense (UFF)
 7 Universidade Federal do Rio de Janeiro (UFRJ)
 8 Centro Universitário La Salle
 9 Universidade Federal do Rio de Janeiro (UFRJ)
10 Aarhus University
Endereço de e-Mail do Autor 1 losalles@mn.ufrj.br
 2
 3 peter.toledo@inpe.br
TítuloA new record of a scelidotheriine ground sloth (Xenarthra, Mylodontidae) from Central Brazil: quaternary cave stratigraphy, taxonomy and stable isotopes
RevistaPalaeogeography, Palaeoclimatology, Palaeoecology
Ano2016
Volume461
MêsNov.
Palavras-ChaveCentral Brazil, karst of Serra da Mesa, cave stratigraphy, megafauna, Scelidotheriinae, microvertebrate associations, Isotopes.
ResumoAn upper fourth molariform of a Scelidotheriine ground sloth is reported from Cameiro Cave, which is located in the karstic region of Serra da Mesa (Goias). In this limestone cave the tooth was found at the base of a depositional sequence, associated with a 2 m thick debris flows deposit, which is covered by the lowest carbonate crust dated at approximately 200,000 yr BP. Detailed morphological description, stable isotope data and stratigraphic context are provided. This represents the first megafauna record for this region of Central Brazil, where this record is found in direct association with a diverse microvertebrate fauna.
Páginas253-260
Idiomaen
Tipo de Trabalhojournal article
Tipo SecundárioPRE PI
DivulgaçãoWEBSCI; PORTALCAPES; AGU; MGA; COMPENDEX.
AreaCST
Nota SecundáriaA1_INTERDISCIPLINAR A1_GEOGRAFIA A1_ENGENHARIAS_III A1_CIÊNCIAS_AMBIENTAIS A1_BIODIVERSIDADE A2_SAÚDE_COLETIVA A2_GEOCIÊNCIAS A2_CIÊNCIAS_AGRÁRIAS_I B1_QUÍMICA B1_ENGENHARIAS_IV B1_CIÊNCIAS_BIOLÓGICAS_I B2_ASTRONOMIA_/_FÍSICA C_FILOSOFIA/TEOLOGIA:subcomissão_FILOSOFIA
Tamanho2658 KiB
Número de Arquivos1
Arquivo Alvosalles_new][.pdf
Última Atualização2016:11.14.11.36.55 sid.inpe.br/mtc-m21b/2013/09.26.14.25.20 simone
Última Atualização dos Metadados2018:06.04.02.41.17 sid.inpe.br/mtc-m21b/2013/09.26.14.25.20 administrator {D 2016}
Estágio do Documentoconcluido
É a matriz ou uma cópia?é a matriz
Espelhourlib.net/www/2011/03.29.20.55
e-Mail (login)simone
Grupo de Usuáriossimone
Grupo de Leitoresadministrator
simone
Visibilidadeshown
Transferível1
Acervo Hospedeirosid.inpe.br/mtc-m21b/2013/09.26.14.25.20
Tipo do ConteudoExternal Contribution
Estágio do Documentonot transferred
Tipo de Versãopublisher
Política de Arquivamentodenypublisher denyfinaldraft24
Permissão de Leituradeny from all and allow from 150.163
Unidades Imediatamente Superiores8JMKD3MGPCW/3F3T29H
Conteúdo da Pasta sourcenão têm arquivos
Conteúdo da Pasta agreement
agreement.html 14/11/2016 09:36 1.0 KiB 
Histórico2016-11-14 11:36:55 :: simone -> administrator ::
2016-11-14 11:36:56 :: administrator -> simone :: 2016
2016-11-14 11:38:31 :: simone -> administrator :: 2016
2018-06-04 02:41:17 :: administrator -> simone :: 2016
Campos Vaziosalternatejournal archivist callnumber copyholder copyright creatorhistory descriptionlevel e-mailaddress format isbn label lineage mark nextedition notes number orcid parameterlist parentrepositories previousedition previouslowerunit progress project rightsholder secondarydate secondarykey session shorttitle sponsor subject tertiarymark tertiarytype url
Data de Acesso19 out. 2020
atualizar 
similares 
Tipo da ReferênciaJournal Article
Identificador8JMKD3MGP3W34P/3MPQ9AE
Repositóriosid.inpe.br/mtc-m21b/2016/11.11.16.59
Metadadossid.inpe.br/mtc-m21b/2016/11.11.16.59.15
Sitemtc-m21b.sid.inpe.br
DOI10.1002/2016JD025263
ISSN2169-8996
2169-897X
Código do Detentorisadg {BR SPINPE} ibi 8JMKD3MGPCW/3DT298S
Chave de CitaçãoWebbBPGGPBCCDFGMWW:2016:CHCoOv
Autor 1 Webb, Alex J.
 2 Bosch, Hartmut
 3 Parker, Robert J.
 4 Gatti, Luciana Vanni
 5 Gloor, Emanuel
 6 Palmer, Paul I.
 7 Basso, Luana S.
 8 Chipperfield, Martyn P.
 9 Correia, Caio S. C.
10 Domingues, Lucas G.
11 Feng, Liang
12 Gonzi, Siegfried
13 Miller, John B.
14 Warneke, Thorsten
15 Wilson, Christopher
Grupo 1
 2
 3
 4 CST-CST-INPE-MCTI-GOV-BR
Afiliação 1 University of Leicester
 2 University of Leicester
 3 University of Leicester
 4 Instituto Nacional de Pesquisas Espaciais (INPE)
 5 University of Leeds
 6 University of Edinburgh
 7 Instituto de Pesquisas Energéticas e Nucleares (IPEN)
 8 University of Leeds
 9 Instituto de Pesquisas Energéticas e Nucleares (IPEN)
10 Instituto de Pesquisas Energéticas e Nucleares (IPEN)
11 University of Edinburgh
12 University of Edinburgh
13 National Oceanic and Atmospheric Administration (NOAA)
14 University of Bremen
15 University of Leeds
Endereço de e-Mail do Autor 1
 2
 3
 4 luciana.gatti@inpe.br
TítuloCH4 concentrations over the Amazon from GOSAT consistent with in situ vertical profile data
RevistaJournal of Geophysical Research: Atmospheres
Ano2016
Volume121
Número18
MêsSept.
Palavras-ChaveGOSAT, amazon, methane, wetlands, aircraft, CH4.
ResumoThe Amazon Basin contains large wetland ecosystems which are important sources of methane (CH4). Spaceborne observations of atmospheric CH4 can provide constraints on emissions from these remote ecosystems, but lack of validation precludes robust estimates. We present the first validation of CH4 columns in the Amazon from the Greenhouse gases Observing SATellite (GOSAT) using aircraft measurements of CH4 over five sites across the Amazon Basin. These aircraft profiles, combined with stratospheric results from the TOMCAT chemical transport model, are vertically integrated allowing direct comparison to the GOSAT XCH4 measurements (the column-averaged dry air mole fraction of CH4). The measurements agree within uncertainties or show no significant difference at three of the aircraft sites, with differences ranging from -1.9ppb to 6.6ppb, while at two sites GOSAT XCH4 is shown to be slightly higher than aircraft measurements, by 8.1ppb and 9.7ppb. The seasonality in XCH4 seen by the aircraft profiles is also well captured (correlation coefficients from 0.61 to 0.90). GOSAT observes elevated concentrations in the northwest corner of South America in the dry season and enhanced concentrations elsewhere in the Amazon Basin in the wet season, with the strongest seasonal differences coinciding with regions in Bolivia known to contain large wetlands. Our results are encouraging evidence that these GOSAT CH4 columns are generally in good agreement with in situ measurements, and understanding the magnitude of any remaining biases between the two will allow more confidence in the application of XCH4 to constrain Amazonian CH4 fluxes.
Páginas11006-11020
Idiomaen
Tipo de Trabalhojournal article
Tipo SecundárioPRE PI
DivulgaçãoWEBSCI
AreaCST
Tamanho1914 KiB
Número de Arquivos1
Arquivo AlvoWebb_ch4.pdf
Última Atualização2016:11.11.16.59.15 sid.inpe.br/mtc-m21b/2013/09.26.14.25.20 administrator
Última Atualização dos Metadados2018:06.04.02.41.16 sid.inpe.br/mtc-m21b/2013/09.26.14.25.20 administrator {D 2016}
Estágio do Documentoconcluido
É a matriz ou uma cópia?é a matriz
Espelhourlib.net/www/2011/03.29.20.55
e-Mail (login)simone
Grupo de Usuáriossimone
Grupo de Leitoresadministrator
simone
Visibilidadeshown
Transferível1
Acervo Hospedeirosid.inpe.br/mtc-m21b/2013/09.26.14.25.20
Tipo do ConteudoExternal Contribution
Estágio do Documentonot transferred
Tipo de Versãopublisher
Política de Arquivamentodenypublisher6 allowfinaldraft
Permissão de Leituraallow from all
Unidades Imediatamente Superiores8JMKD3MGPCW/3F3T29H
Conteúdo da Pasta sourcenão têm arquivos
Conteúdo da Pasta agreement
agreement.html 11/11/2016 14:59 1.0 KiB 
Histórico2016-11-11 16:59:15 :: simone -> administrator ::
2016-11-11 17:02:30 :: administrator -> simone :: 2016
2016-11-11 17:05:29 :: simone -> administrator :: 2016
2018-06-04 02:41:16 :: administrator -> simone :: 2016
Campos Vaziosalternatejournal archivist callnumber copyholder copyright creatorhistory descriptionlevel e-mailaddress format isbn label lineage mark nextedition notes orcid parameterlist parentrepositories previousedition previouslowerunit progress project resumeid rightsholder secondarydate secondarykey secondarymark session shorttitle sponsor subject tertiarymark tertiarytype url
Data de Acesso19 out. 2020
atualizar 
similares